bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0769_orf1 Length=152 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_3790 174 6e-43 > 5807.cgd7_3790 Length=816 Score = 174 bits (441), Expect = 6e-43, Method: Composition-based stats. Identities = 79/153 (51%), Positives = 111/153 (72%), Gaps = 1/153 (0%) Query 1 HFVRCVKPNDAKKPLDWVQSKVLIQLHALSVLEALQLRQVGFSYRRPFKDFLYQFKFIDL 60 HF+RCVKPN++KKPLDW+ SKVLIQLH+LS+LEALQLR +GFSYRR F +F+YQFK+ D+ Sbjct 654 HFIRCVKPNESKKPLDWLASKVLIQLHSLSILEALQLRNLGFSYRRTFSEFIYQFKYCDM 713 Query 61 GITENPSLSPRAACEALLEKAKVDSKSCQVGKTMVFLKQEGAKQLTLLQRQCLSAWTPIV 120 + P+ E +L + S +GKTMVFL ++ AK++ LQR+ L+A+ P+V Sbjct 714 SAANDKKTDPKILAEKMLSGTNIPKNSWAIGKTMVFLSKDAAKRMAQLQREKLAAFEPLV 773 Query 121 AVLESVYMRFRLKQMLSKKQ-HYLVRAQAHIRR 152 +LE+VY+R++L++ K Q LVR QA +RR Sbjct 774 QLLEAVYLRYKLRREFRKNQLKPLVRIQAQLRR 806 Lambda K H 0.326 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22586169780 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40