bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0767_orf1 Length=140 Score E Sequences producing significant alignments: (Bits) Value 5833.PFL0335c 234 6e-61 > 5833.PFL0335c Length=565 Score = 234 bits (597), Expect = 6e-61, Method: Compositional matrix adjust. Identities = 107/132 (81%), Positives = 117/132 (88%), Gaps = 0/132 (0%) Query 9 MQYVNIPRDKEDPNYRYKMPKLLSKIEGRGNGIRTNVYNMGEIARALKRPPMYPTKFFGC 68 M YVNIPRD+ DPNYRYKMPKL+SKIEGRGNGIRTN+ NMGEIAR+LKRPPMYPTKFFGC Sbjct 1 MSYVNIPRDRNDPNYRYKMPKLISKIEGRGNGIRTNISNMGEIARSLKRPPMYPTKFFGC 60 Query 69 ELGAMVKFEENEEKALINGAHSEQDLVAILDKFIQMYVLCGGCELPEIDITVKKGVLFCK 128 ELG MVKFEENEEKA++NGAH E+DLV ILDKFI+MYVLC C LPE DI VKKG+L CK Sbjct 61 ELGTMVKFEENEEKAIVNGAHKEKDLVNILDKFIEMYVLCPHCLLPETDIVVKKGILICK 120 Query 129 CNACGYSGTLDN 140 CNACG G L+N Sbjct 121 CNACGNIGELNN 132 Lambda K H 0.321 0.140 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22914837435 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40