bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0759_orf1 Length=131 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL1P1.43 85.1 6e-16 > 5833.MAL1P1.43 Length=162 Score = 85.1 bits (209), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 43/80 (53%), Positives = 60/80 (75%), Gaps = 3/80 (3%) Query 50 RLQVLGSAPSISIDKSQKVDLFLSNESREVEITSSKSSEMNLNVPLEGEEGDWQEIAIPE 109 ++QVLG + SISIDK V+ +LS E+ E E T++ SSEMN+++ +G++ +W EI IPE Sbjct 84 KIQVLGKSSSISIDKCTGVEFYLSKENVECEFTTALSSEMNIHI--QGQDEEWTEITIPE 141 Query 110 QFHHKLKPDGKLHTRVSDLY 129 QF H L+ +GKL TRVSDLY Sbjct 142 QFQHHLE-NGKLTTRVSDLY 160 Lambda K H 0.324 0.139 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22935578866 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40