bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0737_orf1 Length=127 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0038 191 7e-48 > 5833.PF14_0038 Length=115 Score = 191 bits (484), Expect = 7e-48, Method: Compositional matrix adjust. Identities = 86/113 (76%), Positives = 98/113 (86%), Gaps = 0/113 (0%) Query 13 MSRPEPDVTVPAGDPKAGAKVFKAKCAQCHTVNKGGAAKQGPNLFGFLGRASGSADFPYS 72 MSRPEP V VP GD K GAK+FKAKCAQCHT+NKGGA KQGPNL GF GR SG +DFPYS Sbjct 1 MSRPEPQVQVPEGDYKKGAKLFKAKCAQCHTINKGGAVKQGPNLHGFYGRKSGDSDFPYS 60 Query 73 EANKNSGIVWSEKHLWEYLINPKAYIPGTKMVFAGIKKETERANLIAYLAEVT 125 +ANKNSGI+WS+KHL+EYL+NPK YIPGTKM+FAGIKKE ERA+LI YL + + Sbjct 61 DANKNSGIIWSDKHLFEYLLNPKLYIPGTKMIFAGIKKEKERADLIEYLKKAS 113 Lambda K H 0.316 0.132 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22506847341 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40