bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0734_orf1 Length=366 Score E Sequences producing significant alignments: (Bits) Value 377628.YPN_2563 90.9 7e-17 > 377628.YPN_2563 Length=871 Score = 90.9 bits (224), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 58/143 (40%), Positives = 79/143 (55%), Gaps = 21/143 (14%) Query 194 RPGEKFRDEYKPSDYTVDSVDLRFLLEETNTKVSATIVMQRVAGTPPTDLALNGDDLDLA 253 +P K+R +Y+ DYT+ +DL F L+ T V+A ++R GT T L LNG+DL L Sbjct 4 QPQAKYRHDYRAPDYTITDIDLDFALDAQKTTVTAVSKVKR-QGTDVTPLILNGEDLTLI 62 Query 254 SLMVNGKQVKHIGDSNAVAEGEAGYRLGSDGSLIISKAVLPQKAGEPFTLQTEVSIHPKS 313 S+ V+G+ H YR D +L+I + LP FTL IHP + Sbjct 63 SVSVDGQAWPH-------------YR-QQDNTLVIEQ--LPAD----FTLTIVNDIHPAT 102 Query 314 NLKLKGLYVSGSALVTQCEAEGY 336 N L+GLY+SG AL TQCEAEG+ Sbjct 103 NSALEGLYLSGEALCTQCEAEGF 125 Lambda K H 0.312 0.131 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 141041311029 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40