bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0718_orf1 Length=185 Score E Sequences producing significant alignments: (Bits) Value 99883.GSTENP00003417001 189 4e-47 > 99883.GSTENP00003417001 Length=176 Score = 189 bits (480), Expect = 4e-47, Method: Compositional matrix adjust. Identities = 86/163 (52%), Positives = 119/163 (73%), Gaps = 4/163 (2%) Query 19 MKADKSLQQPIKQYQVVGRLIPTASNPSPPALRMRLFAVNKVLAESRFWHLLRKLRKIKK 78 MKA +L ++Y+V+GRL+P+A NP+PP RMR+FA N ++A+SRFW+ + +LRK+KK Sbjct 1 MKASGTL----REYKVIGRLLPSAKNPAPPLYRMRIFAPNHIVAKSRFWYFVSQLRKMKK 56 Query 79 AHGEILEISEIKEKRGTYVKNFGIWLRYDSRTGTHNMYKEVRDLTQNGAISQIYAEMSGR 138 A GEI+ + EK VKNFGIWLRYDSR+GTHNMY+E RDLT +GA++Q Y +M R Sbjct 57 ASGEIVYCGLVHEKTPLKVKNFGIWLRYDSRSGTHNMYREYRDLTTSGAVTQCYRDMGAR 116 Query 139 HRALASSIQIIRIVQLKGKDCRRPHVQQMLDSKLKMPAIRRII 181 HRA A SIQI+++ + CRRP ++Q DSK+K P R++ Sbjct 117 HRARAHSIQIMKVQVIAANKCRRPAIKQFHDSKIKFPLPHRVL 159 Lambda K H 0.323 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 40134932565 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40