bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0717_orf2 Length=164 Score E Sequences producing significant alignments: (Bits) Value 5833.PFL2225w 67.8 1e-10 > 5833.PFL2225w Length=204 Score = 67.8 bits (164), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 39/124 (31%), Positives = 67/124 (54%), Gaps = 3/124 (2%) Query 40 FKDVSGGGGLILTTKAGDLARRLGLAPSLGEIEELKAVAGEYCDISTFATFCKGVAHCND 99 F + S GG + + + + AR+LGLAPS + +++K + G+ + + H D Sbjct 81 FNEKSSGGKISIDNASYN-ARKLGLAPSSIDEKKIKELYGDNLTYEQYLEYLSICVHDKD 139 Query 100 SPKLLAELFGCYDPSCTGKVPLRVVRNILQNCGEVLTNDEVNAVLEA--STEEVDYKAFC 157 + + L ++F +D +CTG + ++NIL G+ LT+ E L A S + +DYK FC Sbjct 140 NVEELIKMFAHFDNNCTGYLTKSQMKNILTTWGDALTDQEAIDALNAFSSEDNIDYKLFC 199 Query 158 ERLL 161 E +L Sbjct 200 EDIL 203 Lambda K H 0.319 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 28631644438 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40