bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0671_orf2 Length=126 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF0940c 114 8e-25 > 5833.PFF0940c Length=806 Score = 114 bits (285), Expect = 8e-25, Method: Compositional matrix adjust. Identities = 75/153 (49%), Positives = 94/153 (61%), Gaps = 30/153 (19%) Query 1 ANKTAGFSGADIAEMCQRAAKAAIRDAIAAEELARAAGTEGMDE---------------- 44 A KTAGFSGAD+AE+CQRAA+AAIRDAI AEE+ + + E ++ Sbjct 657 AQKTAGFSGADLAELCQRAARAAIRDAIDAEEMNKKSKLELSNKKENEQNETNENDVHNK 716 Query 45 -----------DESNVKYEITRKHFEEGLAGARRSVSQTDLSKYDSFRMKFDPIYKSQAA 93 D+ N+KYEITR HF+EGLAGARRSVSQ DL KYD+FR+KFDP+YK++ Sbjct 717 TEQQANDQQKNDDDNIKYEITRHHFKEGLAGARRSVSQADLIKYDNFRIKFDPLYKTKTG 776 Query 94 GGDGTIIVDWPNTDGAATDVGRVDEGDDDDLYS 126 G I+DWP+ D V D+DLYS Sbjct 777 GTGDDFIIDWPDEDNNDDTPAYV---VDEDLYS 806 Lambda K H 0.311 0.129 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22588795449 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40