bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0619_orf2 Length=210 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0070 140 3e-32 > 5833.PF14_0070 Length=690 Score = 140 bits (352), Expect = 3e-32, Method: Composition-based stats. Identities = 69/106 (65%), Positives = 88/106 (83%), Gaps = 0/106 (0%) Query 105 QKKNMVQMTDSTTYNVNQLLRANILSSEYFKSLHQLKSFHEVVAEVAAYADHAEPYCSGS 164 +KKN ++MT++TTYNVN LLR NILSSEYFKSL +K+F EVV E+ +YADH EPYC GS Sbjct 168 EKKNCLEMTNTTTYNVNTLLRNNILSSEYFKSLIPIKTFKEVVDEIHSYADHVEPYCIGS 227 Query 165 TRAPSTLFCCLYKLFTLKLTDKQMHMLLNHRESPYVRCTGFLYLRY 210 RAPSTLFCCLYK FT++L++KQ+ L+ +++S Y+R GFLYLRY Sbjct 228 NRAPSTLFCCLYKFFTMQLSEKQLKSLIENKDSCYIRACGFLYLRY 273 Lambda K H 0.322 0.131 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 53070928551 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40