bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0617_orf1 Length=151 Score E Sequences producing significant alignments: (Bits) Value 5833.PF13_0233 206 1e-52 > 5833.PF13_0233 Length=818 Score = 206 bits (525), Expect = 1e-52, Method: Compositional matrix adjust. Identities = 92/151 (60%), Positives = 126/151 (83%), Gaps = 0/151 (0%) Query 1 AKLDAHSAFLIKHSIGTIKYNAQGFVFKNKDVLKPEMVDVVQASGNPVVRALFEGVKVER 60 AK+ ++ F+I+H+IG I+Y A+ F+ KNKDVL+ ++V+V++ S NP+V+ LFEG +E+ Sbjct 573 AKVASNKNFIIQHTIGPIQYCAESFLLKNKDVLRGDLVEVIKDSPNPIVQQLFEGQVIEK 632 Query 61 GKMAKGSLIGSQFLAQLSKLMTLIGSTEAHFIRCVKPNEEKKPLLWVQSKVLIQLHALSI 120 GK+AKGSLIGSQFL QL+ LM LI STE HFIRC+KPNE KKPL W + K+LIQLHALSI Sbjct 633 GKIAKGSLIGSQFLNQLTSLMNLINSTEPHFIRCIKPNENKKPLEWCEPKILIQLHALSI 692 Query 121 IEALQLRQLGYTYRRQFQEFVEQFQFIELSA 151 +EAL LRQLGY+YRR F+EF+ Q++F++++A Sbjct 693 LEALVLRQLGYSYRRTFEEFLYQYKFVDIAA 723 Lambda K H 0.323 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22675567716 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40