bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0608_orf1 Length=171 Score E Sequences producing significant alignments: (Bits) Value 9986.ENSOCUP00000012883 80.9 1e-14 > 9986.ENSOCUP00000012883 Length=810 Score = 80.9 bits (198), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 53/163 (32%), Positives = 78/163 (47%), Gaps = 13/163 (7%) Query 4 AAAEISAAAGSSSGASSGASAGAAAGAAAAAAAAKSTRLSWSCGDTEGSLNLSSFKVFPC 63 A + G+ G+ G SAGAA+ A ++ R W E + L ++K PC Sbjct 168 AMEALQNGQGTVEGSVEGQSAGAASHAMIEKILSEEPR--WQ----ETTYVLGNYKTEPC 221 Query 64 HQKHSAAHDKKYCPFYHNFRDKRRFPV--TYRAEQCE--EHFDSDSASLQCSKGDACEKS 119 + CP+YHN +D+RR P YR+ C +H D +C GD+C+ Sbjct 222 KKPPRLCRQGYACPYYHNSKDRRRSPRKHKYRSSPCPNVKHGDEWGDPGKCENGDSCQYC 281 Query 120 HNRHELLYHPTIFKQRFCSSYATRNGTERCGRGNFCAFAHSRE 162 H R E +HP I+K C+ ++G+ C RG FCAFAH + Sbjct 282 HTRTEQQFHPEIYKSTKCND-MQQSGS--CPRGPFCAFAHVEQ 321 Lambda K H 0.318 0.126 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 32237076404 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40