bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0534_orf3 Length=255 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL8P1.138 177 3e-43 > 5833.MAL8P1.138 Length=237 Score = 177 bits (449), Expect = 3e-43, Method: Compositional matrix adjust. Identities = 78/190 (41%), Positives = 123/190 (64%), Gaps = 0/190 (0%) Query 53 FVGRSGECTLLYSHGNAEDIFLSFSFFLHLSRVCRADVLLYEYVGYGCSSGKPSERGVYE 112 F+ R+ T+L+ HGN E++++ + +F S++ +V LY+Y+GYG S+G SE+ +Y Sbjct 40 FINRNAPLTILFCHGNGENVYMLYDYFYETSKIWNVNVFLYDYLGYGESTGTASEKNMYL 99 Query 113 SVEAAYKYLTEELHIHPSKIVAYGRSLGSGPSVHLCASEEVGGLILQSALLSVHRVALRL 172 S A Y Y+ L I+P+ IV YG+S+GS +V + +V GLILQSA+LS+ + + Sbjct 100 SGNAVYDYMVNTLKINPNSIVLYGKSIGSCAAVDIAIKRKVKGLILQSAILSLLNICFKT 159 Query 173 RLTFPGDLFVNIKKIKKVKCPVFCIHGANDEVVPIHHGIELYKRARVRVSPLWVGGAGHN 232 R FP D F NIK+IK + C VF IHG +D++VP +HG+ LY++ + +V P WV HN Sbjct 160 RFIFPFDSFCNIKRIKLIPCFVFFIHGTDDKIVPFYHGMCLYEKCKFKVHPYWVVDGKHN 219 Query 233 NVEIVAGREF 242 ++E++ F Sbjct 220 DIELIENERF 229 Lambda K H 0.329 0.143 0.465 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 78655735730 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40