bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0529_orf2 Length=204 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0643 178 8e-44 > 5833.PF14_0643 Length=442 Score = 178 bits (452), Expect = 8e-44, Method: Compositional matrix adjust. Identities = 90/216 (41%), Positives = 143/216 (66%), Gaps = 16/216 (7%) Query 1 QRPGKFMDEFSREFEEEFMKLMRTRYCRTRVLANSVYNNVVCDRHHIHMNSTIWVTLSEF 60 Q KFMD++S FE+EFM+LM+T+YCR R+LAN+VY N++ D+ HIHMN+T+WVTL++F Sbjct 59 QDANKFMDDYSAMFEKEFMRLMKTKYCRARILANTVYTNMISDKGHIHMNATVWVTLTDF 118 Query 61 VQYLGATQKCKIEHTPKGWYVEYIDHEELAKKEEEAKRRKIEKSQEDARMEQIQAMVEES 120 V YLG T KCKIE T +GWY+EYID E++ +++ +R+KIE S E+ + ++I ++E+ Sbjct 119 VLYLGKTGKCKIEQTERGWYLEYIDREKIEREKAYQERKKIEYSYEELKEKKINEAIQEA 178 Query 121 RRRGGFQEPEYTPLQREEGHTVALTFNKTQPES---KERKVNALQQLHEQ-LKQERLSKS 176 +++G F E EYT L+++ + ++ KT ++ K+ K N L + LKQ+ +K Sbjct 179 KKKGTFIESEYTALEKKNDEKIIISSIKTNNDTNSIKDLKPNVNIFLDKNLLKQDSQNKK 238 Query 177 GSQAE------------KRKLSAMEALVLEAEQRKQ 200 S + KR LS ++ L+LE E++K+ Sbjct 239 KSIIDDKNINHRSNTKNKRPLSELDLLILENEEKKK 274 Lambda K H 0.314 0.127 0.354 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 50224503818 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40