bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0516_orf1 Length=181 Score E Sequences producing significant alignments: (Bits) Value 3702.AT2G42270.1 163 3e-39 > 3702.AT2G42270.1 Length=2172 Score = 163 bits (412), Expect = 3e-39, Method: Compositional matrix adjust. Identities = 78/179 (43%), Positives = 117/179 (65%), Gaps = 5/179 (2%) Query 6 SALRQLPHFSTDLVKAAN---AMEVKDVFDFMNMEDGQREKLLASLTQAQLREVAKASNR 62 S L QLPHF+ DL K + ++ +FD + MED +R++LL ++ AQL ++A+ NR Sbjct 1986 SMLLQLPHFTKDLAKRCHENPGNNIETIFDLVEMEDDKRQELL-QMSDAQLLDIARFCNR 2044 Query 63 YPVISLEFELSKTENISPGENIQCTVQLERDLADGDTVGPVYAPLFPKEKEEQWWLVIGQ 122 +P I L +E+ + +SPG++I V LERD+ VGPV AP +PK KEE WWLV+G+ Sbjct 2045 FPNIDLTYEIVGSNEVSPGKDITLQVLLERDMEGRTEVGPVDAPRYPKTKEEGWWLVVGE 2104 Query 123 SASNGLNAIKRISVTKQSSTIKLAFEAPETPGKHQFVLFLMCDSYIGADQEHKFEIRVR 181 + +N L AIKRIS+ +++ +KL F P G+ + L+ MCDSY+G DQE+ F + V+ Sbjct 2105 AKTNQLMAIKRISLQRKAQ-VKLEFAVPTETGEKSYTLYFMCDSYLGCDQEYSFTVDVK 2162 Lambda K H 0.316 0.131 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 37665090561 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40