bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0449_orf1 Length=175 Score E Sequences producing significant alignments: (Bits) Value 62928.azo3905 70.9 2e-11 > 62928.azo3905 Length=385 Score = 70.9 bits (172), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 52/151 (34%), Positives = 73/151 (48%), Gaps = 13/151 (8%) Query 16 GRRGTEVLIAFRGTKTQVEWILNGQAEHAFNWLGEGEGRTAAGFSHIFSAAWPALQVYLA 75 G+ EVLIA RGT ++W+ N LG G AGF + W + Q + Sbjct 71 GQYAGEVLIATRGTAQSLDWLSNLNIGMQ---LGPGGHLVHAGFHEV----WKSFQRDIF 123 Query 76 SVDRPETPLSRILITGYSLGGAVAALMAYGIALNYPMKVDAVIFGAPRTGDSAFTAAWAK 135 R P SRI G+SLGGA+A L A ++ +V FGAPR+GD ++ + +K Sbjct 124 DFLRGRNP-SRIHCVGHSLGGALAMLNADALSAQKVGEVSLYTFGAPRSGDVFYSRSMSK 182 Query 136 RVNGRN---VAFTLDPIPRTPCKEMPACDKP 163 R+ N V+ + DP+P P P C P Sbjct 183 RLGADNIHRVSASSDPVPMIPL--FPFCHMP 211 Lambda K H 0.320 0.136 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 34716851512 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40