bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0424_orf1 Length=152 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0368 211 5e-54 > 5833.PF14_0368 Length=195 Score = 211 bits (537), Expect = 5e-54, Method: Compositional matrix adjust. Identities = 91/151 (60%), Positives = 122/151 (80%), Gaps = 0/151 (0%) Query 1 DFTFVCPSEIVAFSKAVDEFEARNVQVLGCSIDSKFTHHAWRSQELKNGGIGPVRIPLLA 60 DFTFVCPSEI+A KA+D F+ RNV+++GCS+DSK+TH AW+ L GGIG ++ L++ Sbjct 45 DFTFVCPSEIIALDKALDAFKERNVELIGCSVDSKYTHLAWKKTPLTKGGIGNIQHTLIS 104 Query 61 DVKKEVARAFGVLLPDGMALRGLFLIDKEGIVQHALVNSLAIGRSVPEALRVVDALQHHE 120 D+ K ++R++ VL D ++LR LIDK+G+VQH LVN+LAIGRSV E LR++DA+QHHE Sbjct 105 DITKSISRSYNVLFGDSVSLRAFVLIDKQGVVQHLLVNNLAIGRSVEEVLRIIDAVQHHE 164 Query 121 KYGDVCPANWQKGEKAMKPSAEGVAEYLGSL 151 ++GDVCPANW+KG+ AMKPS EGV+EYL L Sbjct 165 QHGDVCPANWKKGKVAMKPSEEGVSEYLSKL 195 Lambda K H 0.320 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22586169780 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40