bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0419_orf1 Length=153 Score E Sequences producing significant alignments: (Bits) Value 290398.Csal_0643 114 7e-25 > 290398.Csal_0643 Length=497 Score = 114 bits (286), Expect = 7e-25, Method: Composition-based stats. Identities = 59/149 (39%), Positives = 91/149 (61%), Gaps = 12/149 (8%) Query 7 WAVCGIGILPGDKRMSNVLHEQEFLYTVLTR-SQRVCEARVIGALMDFVYAPEEPLRLKG 65 WA+ G+G++PGD RM + L Q+ LYT++ + E RVIG+L+D+++AP++P + Sbjct 59 WAIIGVGVMPGDTRMRDALAAQDHLYTLVVKHPDGRYEPRVIGSLIDYLFAPDDPEAVIE 118 Query 66 LLLDIRTKLLSLTITEKGYCM-ATNGDLDKSLAAVKQDLALMKCKDIRKQESCTPQTALG 124 + D +++SLT+TE GY + NG+ D + V+ DLA + TP+T G Sbjct 119 AMSDPAIRIVSLTVTEGGYNIDPANGEYDLATPDVRHDLASPQ----------TPRTTFG 168 Query 125 LIYLGLKLRRDAKIRPFTVLSCDNIPNNG 153 L+ L+ RR+ I PFTV+SCDNI NG Sbjct 169 LVIAALQRRRERGIAPFTVMSCDNIEGNG 197 Lambda K H 0.323 0.140 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23213563385 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40