bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0401_orf2 Length=233 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI1135c 116 5e-25 > 5833.PFI1135c Length=222 Score = 116 bits (291), Expect = 5e-25, Method: Compositional matrix adjust. Identities = 48/116 (41%), Positives = 78/116 (67%), Gaps = 1/116 (0%) Query 115 LLEQRLSFLGCRSVTSVGDGNCQFRSCALNLFGSERFHMLVRREAVAQMQRQREVYAQFF 174 +LE RL +GC + +GDGNC FRS + NLF +++HM VR++ V M +E Y+ +F Sbjct 83 ILEHRLWAIGCELIEVIGDGNCLFRSISRNLFHKQKYHMYVRKKCVEYMINYKEEYSIYF 142 Query 175 ESPQLLDRYLRDMNRKGTWGDELSLRAIADAFCCSIHLITSTPSSWYPRYDPERGG 230 E+ + +Y+++M++ G WGDEL ++A ADAF C I++ITST +W+ +Y+ + Sbjct 143 ENNE-FQQYIKNMSKNGYWGDELCIKATADAFDCIIYIITSTLENWHLKYESKNNN 197 Lambda K H 0.316 0.130 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 66220486273 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40