bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0396_orf1 Length=140 Score E Sequences producing significant alignments: (Bits) Value 10090.ENSMUSP00000000349 84.7 8e-16 > 10090.ENSMUSP00000000349 Length=482 Score = 84.7 bits (208), Expect = 8e-16, Method: Composition-based stats. Identities = 40/74 (54%), Positives = 50/74 (67%), Gaps = 10/74 (13%) Query 74 IFSISQPRHG----------IVCFKLADIGEGIAAVELTKWYKKEGDTIEEMEEVCEVQS 123 +F SQPRH +V FKL+DIGEGI V + +WY KEGDT+ + + +CEVQS Sbjct 44 LFKYSQPRHSLRTAAVLQGQVVQFKLSDIGEGIREVTIKEWYVKEGDTVSQFDSICEVQS 103 Query 124 DKAAVEITSRYPGV 137 DKA+V ITSRY GV Sbjct 104 DKASVTITSRYDGV 117 Lambda K H 0.322 0.135 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22914837435 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40