bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0380_orf1 Length=114 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd3_3950 66.6 2e-10 > 5807.cgd3_3950 Length=299 Score = 66.6 bits (161), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 38/98 (38%), Positives = 57/98 (58%), Gaps = 6/98 (6%) Query 17 QAKAMLEQQAKLEEETRKRALEQLQRGKEEAKRERERQRELLRQDYRDRFGCEMPEDPSQ 76 K +LE Q KLEE R R +E+ + K + ER+RQ LL++++ +RFGC PE+ + Sbjct 124 STKQLLEAQRKLEEAERIRNIEKAAKEKNAHEVERQRQLSLLKEEWEERFGCPYPEEKTN 183 Query 77 ADPEERLAKMSGKEKVAYYSNALFKRYKKEDPQKLLVC 114 P+ KEKVAYY N + K Y+ +D Q ++ C Sbjct 184 EVPK------GNKEKVAYYCNRMNKEYRSKDLQGIMTC 215 Lambda K H 0.311 0.128 0.340 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22778399648 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40