bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0350_orf3 Length=189 Score E Sequences producing significant alignments: (Bits) Value 5207.CND04310 119 4e-26 > 5207.CND04310 Length=331 Score = 119 bits (299), Expect = 4e-26, Method: Compositional matrix adjust. Identities = 51/81 (62%), Positives = 67/81 (82%), Gaps = 1/81 (1%) Query 1 TKQEKYHKIMEKKMSTPVEVLCKGYPAEFATYLNYCRQLRFEDRPDYAYLRGLFKDLYIK 60 TK++KY +IMEKKM+TP EVLC+G+P EFA YLNYCR LRF+D+PDY+YLR LF+DL+I+ Sbjct 223 TKKQKYDRIMEKKMTTPTEVLCRGFPHEFAIYLNYCRSLRFDDKPDYSYLRKLFRDLFIR 282 Query 61 EGFDQQDAAFDWTPKLNARNS 81 EGF Q D FDW+ + ++S Sbjct 283 EGF-QYDYVFDWSLQPGVKSS 302 Lambda K H 0.315 0.131 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 41818451300 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40