bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0336_orf2 Length=153 Score E Sequences producing significant alignments: (Bits) Value 44689.DDBDRAFT_0183814 102 5e-21 > 44689.DDBDRAFT_0183814 Length=380 Score = 102 bits (253), Expect = 5e-21, Method: Compositional matrix adjust. Identities = 48/99 (48%), Positives = 68/99 (68%), Gaps = 2/99 (2%) Query 1 LSVAAVCLD--VQRRRDDADVLIMRSMFQSADLLCCEVQKAQNDGTILLHTRSARYGRLQ 58 L ++A+ L +QRRR AD L MRS F DL+ EVQ DG++ +HTR+ +YG+LQ Sbjct 171 LMLSAINLPGGIQRRRTSADELQMRSFFVENDLVYAEVQMVMGDGSVAIHTRNQKYGKLQ 230 Query 59 NGIGLRVSPQLIKRQSKHIGHLQCGLQLILGVNGFLWIS 97 NG +V P LIKR +H +L+CG+ +ILGVNG++WI+ Sbjct 231 NGHFTKVIPSLIKRSKQHFYNLECGVDVILGVNGYIWIA 269 Lambda K H 0.322 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23213563385 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40