bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0334_orf1 Length=138 Score E Sequences producing significant alignments: (Bits) Value 7955.ENSDARP00000087580 71.2 8e-12 > 7955.ENSDARP00000087580 Length=276 Score = 71.2 bits (173), Expect = 8e-12, Method: Compositional matrix adjust. Identities = 40/85 (47%), Positives = 56/85 (65%), Gaps = 2/85 (2%) Query 8 YYYFGAAKELPGVRELFAGRAEEINEPRKTRAQLFQRITPDYFGWRDEENEDLLLAEQQQ 67 Y YFGAAK+LPGVRELF +E + PRKTRA+L + I DY+G+RDE++ LL EQ+ Sbjct 112 YKYFGAAKDLPGVRELF--ESEPVPPPRKTRAELMKDIDADYYGYRDEDDGVLLPLEQEY 169 Query 68 EQLWQQQQEEELQQQQELLESVGAA 92 E+ + E+ + +E +VG A Sbjct 170 EKQVMAEAVEKWKADKEARLAVGGA 194 Lambda K H 0.310 0.126 0.345 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22344559178 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40