bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0331_orf1 Length=179 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF0520w 122 7e-27 > 5833.PFF0520w Length=509 Score = 122 bits (305), Expect = 7e-27, Method: Compositional matrix adjust. Identities = 55/162 (33%), Positives = 100/162 (61%), Gaps = 0/162 (0%) Query 1 VLDGRYNQLCDVWSIGVIVYMLLSGTPPFAGKTDLEIILKIKRCCYSFEGDSWKGVSPLA 60 VLDG+Y++ CD+WS GVI+Y LL G PPF G TD E++ K+K+ + F + W +S A Sbjct 240 VLDGKYDKKCDIWSSGVIMYTLLCGYPPFYGDTDNEVLKKVKKGEFCFYENDWGSISSDA 299 Query 61 KSFISSLLKRSPEDRLTAAEALKHQWLATDEEQQQNKQINIQVFKSMRRFAACTAIQRAA 120 K+ I+ LL +P +R T EAL H W+ + ++ +++ + K+++ F +++ A Sbjct 300 KNLITKLLTYNPNERCTIEEALNHPWITQMTKSHEHVELSSTLLKNLKNFKKENELKKIA 359 Query 121 LGLIALSMPTKDLDELQKLFCALDEEKTGVIRVEGLVNVLQK 162 L +IA + +++ L+ +F ALD + +G + + +++ L+K Sbjct 360 LTIIAKHLCDVEINNLRNIFIALDVDNSGTLSSQEILDGLKK 401 Lambda K H 0.322 0.136 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 36430169559 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40