bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0318_orf1 Length=118 Score E Sequences producing significant alignments: (Bits) Value 4924.PICST_29003 72.4 3e-12 > 4924.PICST_29003 Length=831 Score = 72.4 bits (176), Expect = 3e-12, Method: Composition-based stats. Identities = 31/58 (53%), Positives = 35/58 (60%), Gaps = 8/58 (13%) Query 65 DDGI--------RCDVCANSDTSADDAIVLCDGCDAAVHQSCYNIGALPEGEWFCEYC 114 DDGI RC VC +SD +AIV CDGCD AVHQ CY I +PEG+W C C Sbjct 236 DDGIIPGSIYDQRCAVCNDSDCDNSNAIVFCDGCDIAVHQECYGIAFIPEGQWLCRKC 293 Lambda K H 0.320 0.135 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22460540320 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40