bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0313_orf1 Length=169 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF0535c 77.8 1e-13 > 5833.PFF0535c Length=1280 Score = 77.8 bits (190), Expect = 1e-13, Method: Composition-based stats. Identities = 43/123 (34%), Positives = 72/123 (58%), Gaps = 3/123 (2%) Query 26 KKNSRPEKKFFDRDKVDSSGGQVEQGLIPGTVKFAGLTFEEAGYIIRKIALRHLVLGSAV 85 KK RP +K FDRD+++ GG +E G P T+K+ FEE GYI++K+ +++L+ +A Sbjct 522 KKKERPLQKLFDRDEIERIGGVIETGPYPRTIKYQNNIFEENGYILKKMNIKYLITENA- 580 Query 86 SASLTELKEFCQNMNEADREESLTAHKPLYQMLKQQRSAFRLGDRILITQGELQGLKGRV 145 + +LTE++EF +N A + +L K K F+ +R+ I +GEL L G + Sbjct 581 NITLTEIREFNKNNGMAGEKATLGITKSFIN--KNSLHLFKKDERVKILKGELCNLIGTI 638 Query 146 SGL 148 + + Sbjct 639 TAV 641 Lambda K H 0.316 0.134 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 30997188850 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40