bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0312_orf1 Length=171 Score E Sequences producing significant alignments: (Bits) Value 3702.AT4G34280.1 90.9 1e-17 > 3702.AT4G34280.1 Length=783 Score = 90.9 bits (224), Expect = 1e-17, Method: Composition-based stats. Identities = 51/139 (36%), Positives = 78/139 (56%), Gaps = 4/139 (2%) Query 2 LHSDSINIVRFAHISPHLFVTASFDQTCRLWDLRQRINGHQPLLTVDTGSLSVMCCFDDS 61 +H + IN+V+F++ SP LF T+SFD+ +LWDLRQ + +P T + +VM CF Sbjct 581 MHQEHINVVKFSNHSPFLFATSSFDKDVKLWDLRQEPS--RPCYTASSTKGNVMVCFSPD 638 Query 62 DEWLLCSGVDAALRQVCVRSSTVFPQSFAIPPVNAETNFRRAVYLQGGREFITAGTEEGF 121 D +LL S VD +RQ+ + +F I P + N+ R+ Y+ G I+ +E Sbjct 639 DRYLLASAVDNEVRQLLTVDGRLH-LNFEIVPRVSSMNYTRSYYMNGNDYIISGSCDENV 697 Query 122 FRV-FSRLGRDLGLVSLEG 139 RV ++ GR L V+LEG Sbjct 698 IRVCCAQTGRRLRDVTLEG 716 Lambda K H 0.327 0.141 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 32237076404 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40