bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0289_orf1 Length=143 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF0290w 76.3 3e-13 > 5833.PFF0290w Length=293 Score = 76.3 bits (186), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 42/107 (39%), Positives = 63/107 (58%), Gaps = 0/107 (0%) Query 13 YLHLLGERECGYDGEIYYVVALNALVHVVMYAYYFMASLNSPLARTIKIFVTQLQMAQFL 72 +L + GYDG+IYY++ +N+ VH VMY YY+++S+ + K VT LQM QFL Sbjct 181 FLIMWVNTSVGYDGDIYYIIVVNSFVHFVMYLYYYLSSVKFKVPIFAKACVTYLQMLQFL 240 Query 73 SMTAHACYHVYFYKSCRYPVRVTIGYFFYVLSLFLLFRNFSKKTYGK 119 S+ Y ++ C YP ++ F+Y +SL +LF NF+ TY K Sbjct 241 SIILPGFYVLFVRHYCPYPRKLVGLSFYYCISLLILFGNFALHTYIK 287 Lambda K H 0.329 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22654093455 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40