bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0278_orf1 Length=131 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI0755c 169 2e-41 > 5833.PFI0755c Length=1418 Score = 169 bits (428), Expect = 2e-41, Method: Composition-based stats. Identities = 79/124 (63%), Positives = 100/124 (80%), Gaps = 1/124 (0%) Query 1 GRSASHLVLECAMQARPNLVFIGEEVERENMSLEHIVQELVDLVVKRAEQGKMYGVILVP 60 GRSASH+VLECA+Q RPN+V IGEEVE+ N+SL+ IV+ +V++++KR K YGVIL+P Sbjct 359 GRSASHVVLECALQTRPNVVLIGEEVEQLNLSLKDIVKNIVNIILKRKSLNKNYGVILLP 418 Query 61 EGLIEFIPEMKQLIKELNSVLKAGQPFKPELLKTTRAVWDFLPDVIQDQLLMDRESTGYI 120 EGLIEF+PEMK LI ELN +LK G PF L+ ++ VWDFLP +I+DQLLMDRESTGYI Sbjct 419 EGLIEFVPEMKILISELNVILKDG-PFDASKLQKSKEVWDFLPPIIRDQLLMDRESTGYI 477 Query 121 QASE 124 Q + Sbjct 478 QVGK 481 Lambda K H 0.320 0.138 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22935578866 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40