bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0277_orf1 Length=153 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_2130 65.1 6e-10 > 5807.cgd2_2130 Length=1426 Score = 65.1 bits (157), Expect = 6e-10, Method: Composition-based stats. Identities = 43/105 (40%), Positives = 57/105 (54%), Gaps = 14/105 (13%) Query 49 GKVHLHSADLFERSSPLQRLRRAWRCTLPSALESTQLRLVEADCPVEHPSLRQTPEVQQQ 108 GK HLHSADLFE SP+Q R+ W TLP +L S +++ E +E P L Q E + Sbjct 72 GKPHLHSADLFENFSPVQLERQKWVPTLPYSLSSNCIKIKE----IEIPDLIQKDE--NK 125 Query 109 LRGFFPATFGKKYVEVVPGMGSGVASPKEPLDHPLSKALRIGIVL 153 L+ P TFG+ +E+ + E DH ALR+GIVL Sbjct 126 LKELLPNTFGRPCIEIT----RDESKNSENSDH----ALRVGIVL 162 Lambda K H 0.316 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23213563385 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40