bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0275_orf1 Length=147 Score E Sequences producing significant alignments: (Bits) Value 9598.ENSPTRP00000016565 263 1e-69 > 9598.ENSPTRP00000016565 Length=411 Score = 263 bits (672), Expect = 1e-69, Method: Compositional matrix adjust. Identities = 119/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%) Query 1 MISDRHFSTRFIKMLVLDEADEMLNRGFKQQVYDIYRYLPPSTQVVLISATLPHEVLEMT 60 MI R TR IKMLVLDEADEMLN+GFK+Q+YD+YRYLPP+TQVVLISATLPHE+LEMT Sbjct 170 MIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMT 229 Query 61 TKFMSNPFRVLVKRDELTLEGIKQFFVAVEREHWKFDTLTDLYDTLTITQAVVFCNTKTK 120 KFM++P R+LVKRDELTLEGIKQFFVAVERE WKFDTL DLYDTLTITQAV+FCNTK K Sbjct 230 NKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRK 289 Query 121 VEWLAQKLKEANFTVSRIHGDMPQKER 147 V+WL +K++EANFTVS +HGDMPQKER Sbjct 290 VDWLTEKMREANFTVSSMHGDMPQKER 316 Lambda K H 0.324 0.136 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23033159460 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40