bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0250_orf3 Length=105 Score E Sequences producing significant alignments: (Bits) Value 272563.CD0026 91.7 6e-18 > 272563.CD0026 Length=815 Score = 91.7 bits (226), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 39/74 (52%), Positives = 58/74 (78%), Gaps = 0/74 (0%) Query 32 VAHILHLWTGIPLGKMTEDEISRVLRLADILSSRVIGQQQAVKAVADALAIQRAGLSPKN 91 +A ++ LWTGIP+ K+ E+E R+LRL +IL +RVIGQ+QAVK+++ A+ RAGL N Sbjct 481 IAEVVGLWTGIPVNKILEEEADRLLRLEEILHNRVIGQEQAVKSISKAIRRSRAGLKDPN 540 Query 92 KPLGTFMFLGSSGV 105 +P+G+F+FLG +GV Sbjct 541 RPIGSFLFLGPTGV 554 Lambda K H 0.318 0.133 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22682427107 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40