bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0239_orf2 Length=143 Score E Sequences producing significant alignments: (Bits) Value 8090.ENSORLP00000019353 72.4 4e-12 > 8090.ENSORLP00000019353 Length=1623 Score = 72.4 bits (176), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 42/97 (43%), Positives = 55/97 (56%), Gaps = 5/97 (5%) Query 48 EEGEEDEDGECGAAAGAAGAAGVPVSAASAAAAAAEVCVPSCVLLP--PKPHQVEGLRWL 105 E ++D D E G A+ G A A A +V S +L+ K +Q++GL WL Sbjct 688 EHAKQDVDDEYGNASFQRGLQSY---YAVAHAVTEKVDKQSSLLINGQLKQYQIKGLEWL 744 Query 106 ARLHAKGLSGLLADEMGLGKTYQTIAFLGYLQEYKHI 142 L+ L+G+LADEMGLGKT QTIA + YL EYK I Sbjct 745 VSLYNNNLNGILADEMGLGKTIQTIALITYLMEYKRI 781 Lambda K H 0.306 0.124 0.347 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22654093455 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40