bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0236_orf1 Length=155 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF0185c 135 3e-31 > 5833.PFF0185c Length=1820 Score = 135 bits (341), Expect = 3e-31, Method: Composition-based stats. Identities = 61/154 (39%), Positives = 90/154 (58%), Gaps = 9/154 (5%) Query 2 EEPSKQQETGDESPKVAEEPRVPTEWKMPVSSGSYAVEQVAKWNWYYRMEQIYYLWQQNV 61 E PSK +E PK W + Y Q+++WNWYY +E+ Y+ WQ Sbjct 1676 ENPSKTKEDFSYPPKT---------WSRLNPTSKYVAHQISQWNWYYSLEEQYFNWQYYK 1726 Query 62 FPVKPNHVFCGFPIHLATSDSTEIRSYLGGSRRFRRLLDMPVENITYVVTGKCYPLMGGV 121 FPV PNH F GFPIH +T D TE++S+L S+RF ++ + + I++V+ K YPL+GGV Sbjct 1727 FPVPPNHTFVGFPIHFSTIDFTEVKSFLLHSKRFENIMKLSIYKISFVIYSKVYPLIGGV 1786 Query 122 ISTWLFFGAQVPLASSQERKSHMTRIRKPPHTKQ 155 +S W+F G VP ++QER++ M + K K+ Sbjct 1787 MSNWVFLGCLVPWMTAQERETKMKKTPKKNMNKR 1820 Lambda K H 0.318 0.133 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23746592502 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40