bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0219_orf2 Length=119 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0421 120 1e-26 > 5833.PF14_0421 Length=265 Score = 120 bits (301), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 60/115 (52%), Positives = 74/115 (64%), Gaps = 1/115 (0%) Query 2 SKVDPWVLGSVLLRYPSIYVVKRSLLKVPIAGWALYMGGTLSVQFTKDKGGWGTKPGSVQ 61 S VDPWV+ + +P +V K SLLKVPI G ALY G++ + FTKDKGGWG K G VQ Sbjct 78 SSVDPWVVNATTFPWPIKFVFKSSLLKVPIGGQALYFSGSIPLHFTKDKGGWGVKQGEVQ 137 Query 62 DMMKEALRNLAEGVFVVVFPEGTRSVTGRLQPFKNGFFRLAAENPDIHILPIAIH 116 +M + + +FPEGTRSV G LQ FK+GFFR A EN + ILP A+H Sbjct 138 KIMNICKEYQDMNIPLAIFPEGTRSVQGHLQLFKSGFFRFAIEN-NCEILPCALH 191 Lambda K H 0.322 0.140 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22381075488 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40