bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0153_orf1 Length=207 Score E Sequences producing significant alignments: (Bits) Value 44689.DDBDRAFT_0189390 91.3 2e-17 > 44689.DDBDRAFT_0189390 Length=719 Score = 91.3 bits (225), Expect = 2e-17, Method: Composition-based stats. Identities = 47/104 (45%), Positives = 64/104 (61%), Gaps = 4/104 (3%) Query 80 FQDIAPDAFECAREVAGISDQDYRTSLCST----DFPFIEFQSNSKSGQFFFFSHDGKFL 135 F+D P+AF R + GI D+ SLC+T + E + KSG FFFSHD KF+ Sbjct 378 FKDYCPNAFRYLRYLFGIDTADFMVSLCNTLKNGENALRELPTPGKSGSLFFFSHDMKFI 437 Query 136 IKTISKAEVIQILRVLPSYIDHILSTPLSLLTRIFGIHRVELYT 179 IKTI K E + +LPSY++HI S P SLL R FG++RV+ ++ Sbjct 438 IKTIPKDEAKLLRDILPSYLEHIQSNPNSLLPRFFGLYRVKPHS 481 Lambda K H 0.322 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 52061985665 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40