bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0146_orf1 Length=151 Score E Sequences producing significant alignments: (Bits) Value 7719.ENSCINP00000013405 83.6 2e-15 > 7719.ENSCINP00000013405 Length=242 Score = 83.6 bits (205), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 49/149 (32%), Positives = 80/149 (53%), Gaps = 16/149 (10%) Query 3 DFDASSPYVPVALLGRGAVGRVFRCTERSSGDSVAVKVVYKRPLRSRSRLRRQVLIEKEA 62 DFD + ++G+G+ G+V R G+ AVKV+ KR + R+ ++ ++ E+ Sbjct 105 DFDY------LKVIGKGSFGKVLLAKHRHDGNFYAVKVLQKRSIMKRNE-QKHIMAERNV 157 Query 63 LVALSAGGRSVHPSVVHLRRTYQTAESLYFVLHYAGAASLRDVLRRLSCAGLSLSVGAAR 122 L+ HP +V L ++QT+E LYFVL Y L L+R + AR Sbjct 158 LLK-----NLKHPFLVGLHYSFQTSEKLYFVLDYVNGGELFFHLQRER----TFHEPRAR 208 Query 123 LWAAEIAAALAAMRGRGVLHRDIRPENIV 151 +AAEIA+A+ M +++RD++PENI+ Sbjct 209 FYAAEIASAVGYMHSHAIIYRDLKPENIL 237 Lambda K H 0.325 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22675567716 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40