bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0136_orf1 Length=150 Score E Sequences producing significant alignments: (Bits) Value 3702.AT5G22920.1 77.0 1e-13 > 3702.AT5G22920.1 Length=291 Score = 77.0 bits (188), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 35/62 (56%), Positives = 46/62 (74%), Gaps = 3/62 (4%) Query 91 QLGCSHYRRKCKIVAPCCKEIYWCRHCHNEAYESDLVK---AHEIDRHAVEEIVCAVCET 147 GCSHYRR+CKI APCC EI+ CRHCHNEA +S ++ HE+ RH V +++C++CET Sbjct 24 HYGCSHYRRRCKIRAPCCDEIFDCRHCHNEAKDSLHIEQHHRHELPRHEVSKVICSLCET 83 Query 148 RQ 149 Q Sbjct 84 EQ 85 Lambda K H 0.304 0.119 0.343 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22764965652 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40