bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0135_orf1 Length=146 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd3_2180 103 2e-21 > 5807.cgd3_2180 Length=8243 Score = 103 bits (256), Expect = 2e-21, Method: Composition-based stats. Identities = 47/140 (33%), Positives = 78/140 (55%), Gaps = 10/140 (7%) Query 1 VFKFVPLMQFMRKYWFDSEQRTDDFPIENKNIFEDLPDAKWPDQRDIFKNSLLYSVQSGF 60 +FKFVPLMQ+ R YWFD+ +RT FP++ N+ ED+P+ WP F+NS LY + G+ Sbjct 7829 IFKFVPLMQYWRHYWFDNTERTQPFPVDTSNVSEDMPEISWPPLEITFQNSFLYCAKRGY 7888 Query 61 FPKNSKAIRVDPEACLEDAKR-------MSGLDSLGEDHDYFMKPLHILKDSL---LQES 110 FP NS +I P C DA + ++ +D+ + + DS+ L++ Sbjct 7889 FPSNSSSISFTPIKCYSDALNEIKAELSLRNVNFNQNKYDFICRKMQKNADSIYDSLKKV 7948 Query 111 NPSFCGKLAMFRTVRQQLMN 130 + +FC K + + ++Q ++N Sbjct 7949 SLNFCAKYSYYILLKQSIVN 7968 Lambda K H 0.323 0.138 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22393349475 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40