bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0129_orf5 Length=102 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd6_3860 134 9e-31 > 5807.cgd6_3860 Length=1102 Score = 134 bits (336), Expect = 9e-31, Method: Composition-based stats. Identities = 62/100 (62%), Positives = 80/100 (80%), Gaps = 0/100 (0%) Query 3 RVKKDVLQEMPPKKEVICFVPLSAMQRTLYRDLLTKNVAALQGGEGCGKSQLRNLAVQLR 62 RVK +V ++PPKKE++ +VPL+ MQR LY+DLL+KNV ALQ EG GK +L NLA+QLR Sbjct 408 RVKSEVEIDIPPKKEILLYVPLTNMQRRLYKDLLSKNVDALQEKEGGGKLRLINLAMQLR 467 Query 63 KACNHPYLFEGYEPEGEDPFGEHVILNSGKLRFCDCLLQR 102 KACNHPYLF+GYE + DPFGEHV+ NSGK+ D L+++ Sbjct 468 KACNHPYLFDGYEDKSVDPFGEHVVENSGKMVLMDRLIKK 507 Lambda K H 0.322 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22913371775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40