bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0105_orf5 Length=177 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL3P2.6 186 2e-46 > 5833.MAL3P2.6 Length=525 Score = 186 bits (472), Expect = 2e-46, Method: Compositional matrix adjust. Identities = 85/116 (73%), Positives = 98/116 (84%), Gaps = 0/116 (0%) Query 26 PIPRLCRDPLKWEKVVEVPHIQHTYRNVMTPQYRHIPKPVEVPMTHYRPIPVEKLVDRNV 85 P ++ P EK+VEVPH+QH YRN+++PQYRHIPKPVE+PM HYR PVEK+VDRNV Sbjct 237 PYTQIVDRPYHVEKIVEVPHVQHIYRNIVSPQYRHIPKPVEIPMAHYRTFPVEKIVDRNV 296 Query 86 PVPVELQIVQEYLCPKIEPRYKEVPVPVHVQRTIEHPVPKEAMGNPQLLPLYYQGS 141 PVPVELQIVQE+LCPKIE RYKE+PVPVHVQR IEHP+PK+AM NP LLPLYYQ Sbjct 297 PVPVELQIVQEFLCPKIEARYKEIPVPVHVQRIIEHPIPKDAMNNPHLLPLYYQED 352 Lambda K H 0.319 0.135 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35195248557 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40