bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0072_orf1 Length=116 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_4350 88.2 7e-17 > 5807.cgd2_4350 Length=1281 Score = 88.2 bits (217), Expect = 7e-17, Method: Composition-based stats. Identities = 42/98 (42%), Positives = 62/98 (63%), Gaps = 1/98 (1%) Query 18 PQTPQWWKPEVQAALRLAHHRIASRPSTSRLINPLLAMLDDPEIGPKLRQGDKQIFLDTL 77 P+ +WWK VQ + R+ ST R+I+PL ++ +PE+ LR G+K++F +TL Sbjct 903 PEKLEWWKRAVQDRIFDFVERLERLESTQRVIDPLYNLMKNPELAAALRSGNKKLFQETL 962 Query 78 YYQLMQS-GSPYRQFALDFVWSGSELKTYRMRLLPKYM 114 YY+L + S Y+QF+ DFVW EL TYR++LL K M Sbjct 963 YYELYNNPESNYKQFSFDFVWKERELITYRIKLLAKGM 1000 Lambda K H 0.320 0.134 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22619469984 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40