bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0056_orf1 Length=169 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_3850 217 1e-55 > 5807.cgd8_3850 Length=368 Score = 217 bits (553), Expect = 1e-55, Method: Compositional matrix adjust. Identities = 92/159 (57%), Positives = 128/159 (80%), Gaps = 0/159 (0%) Query 10 SRAGTAQHASTAQSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDSPFEG 69 +R + ++ Q L+RILRE+R+IQ+ S +W A P++++EP EWHFT++GP + FEG Sbjct 38 ARGVGSSGITSVQCLSRILREYREIQKEPSSYWCAFPINMDEPYEWHFTIKGPAGTEFEG 97 Query 70 GMYHGRIVLPKNYPFAPPSLMLLTRNGRFDVNKKICLSASSHHPELWQPAWGIRTLLDAL 129 GMYHGRI+LP +YPF+PPSLM+LT NGRF+V KK+CLSAS++HPELWQPAWGIRT+LDAL Sbjct 98 GMYHGRIILPHSYPFSPPSLMMLTGNGRFEVGKKVCLSASNYHPELWQPAWGIRTMLDAL 157 Query 130 CAFFPTPAQGALHALEASEKDRRQMALESASWVCPVCKR 168 AFFPTP +GA+H+L+ S + R+++A +S +W C C+ Sbjct 158 HAFFPTPGEGAIHSLDWSPEIRKKLAKDSVNWHCNTCQE 196 Lambda K H 0.320 0.133 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 30997188850 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40