bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0035_orf2 Length=122 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd1_1100 84.0 1e-15 > 5807.cgd1_1100 Length=1103 Score = 84.0 bits (206), Expect = 1e-15, Method: Composition-based stats. Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 4/81 (4%) Query 6 APESRP--QLILGNWSHGGRRSCDPFGGSFSCFESDLYKTILRFFDCRLKKKCWGGVEEE 63 A + +P +L+LG W+H GR SC PFG S SCFE LY ++RF DC LK CW ++ Sbjct 736 ASKEKPIYKLVLGPWTHSGRASCSPFGKSISCFEPALYYDLVRFMDCALKGICWE--NQD 793 Query 64 MPVHYWQTGTAEWREALTFPP 84 +H++Q G +W FPP Sbjct 794 KNIHFFQVGEEKWYTTDKFPP 814 Lambda K H 0.319 0.137 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22916587881 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40