bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0016_orf1 Length=158 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_4430 132 4e-30 > 5807.cgd8_4430 Length=214 Score = 132 bits (332), Expect = 4e-30, Method: Compositional matrix adjust. Identities = 54/82 (65%), Positives = 72/82 (87%), Gaps = 0/82 (0%) Query 77 FIDGSGQLFIRGHVCSYEEMLSRIQDLIVKNNPDLAGSKRYTIKPPQVVRVGSKKVAWIN 136 ++DGSGQLF++G + YEE+L R++ LI+++NPDL G+KRYT+KPPQVVRVGSKKVAWIN Sbjct 42 YVDGSGQLFVKGAIYPYEELLERVRRLILEHNPDLWGAKRYTLKPPQVVRVGSKKVAWIN 101 Query 137 FKDICGIMHRPSEHVLQFVLAE 158 F++IC IM R ++HV QFVL+E Sbjct 102 FQEICNIMQRNADHVFQFVLSE 123 Lambda K H 0.314 0.126 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 25621323489 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40