bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0014_orf1 Length=207 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_1430 163 3e-39 > 5807.cgd8_1430 Length=752 Score = 163 bits (413), Expect = 3e-39, Method: Composition-based stats. Identities = 83/213 (38%), Positives = 126/213 (59%), Gaps = 30/213 (14%) Query 1 QLSLVKKVKEMQHGFNVPFQFAHLPAPEEWDGLLQKGLTRLVGIAKQEYGQGNGGKI--- 57 +L +V++VKEMQH FN P+QFA+LP EWD L++KG +V +AK E I Sbjct 541 KLEIVRRVKEMQHEFNCPYQFANLPPEHEWDELIEKGFHDIVRLAKIEKKNKEDSNIMDD 600 Query 58 -------GDEPSAIQSTSVPVQDGDLIILGTDGLFDNVFDFEVLALTGLAVSPHEAQTLL 110 D+P Q VP+++GD++ILGTDGLFDN+FDFE+ +++GL+ SP E++ Sbjct 601 KYSMQLACDDPELSQLLEVPLKEGDMVILGTDGLFDNLFDFEITSISGLSFSPIESKLFY 660 Query 111 GDASLATPPEDVARALALAAYWRSLDRDAQTPFSKEARRCHNKQSLPVQTPDGSSEQGAP 170 T P +A+++AL+AY++SLD ++TPF+ +A+R ++ Sbjct 661 NCLDYTTTPMVIAKSIALSAYYKSLDPFSKTPFANQAKRFYSGGK--------------- 705 Query 171 QASPVHAMFLAGLLSGGKEDDITVAAAWVCRKD 203 +++F + SGGKEDDI+V AWV KD Sbjct 706 -----NSLFESQSFSGGKEDDISVLVAWVVHKD 733 Lambda K H 0.317 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 52061985665 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40