BLASTP 2.2.24 [Aug-08-2010] 

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Eten_8567_orf1
         (186 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           14,777,732 sequences; 5,058,227,080 total letters

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|261211560|ref|ZP_05925848.1| sigma factor RpoE negative regul...    37     1.6  

>gi|261211560|ref|ZP_05925848.1| sigma factor RpoE negative regulatory protein RseA [Vibrio sp.
           RC341]
 gi|260839515|gb|EEX66141.1| sigma factor RpoE negative regulatory protein RseA [Vibrio sp.
           RC341]
          Length = 204

 Score = 36.6 bits (83), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 55  SWKLARGQAPA--HRPPHPPLGHPQKSVEISFA-LFGFPRP-QTPRLLPQWHSSFG 106
            W +A   A A  + P H PL H QK +++  A L   P+P Q  R LP W + FG
Sbjct: 53  EWNIAESVALALENEPAHNPLTHSQKVIDLQQARLEAQPKPQQAKRQLPTWLTQFG 108


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
  from WGS projects
    Posted date:  Jul 22, 2011  4:42 PM
  Number of letters in database: 5,058,227,080
  Number of sequences in database:  14,777,732
  
Lambda     K      H
   0.328    0.142    0.481 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 14777732
Number of Hits to DB: 1,503,596,151
Number of extensions: 59411257
Number of successful extensions: 175758
Number of sequences better than 10.0: 10
Number of HSP's gapped: 177092
Number of HSP's successfully gapped: 10
Length of query: 186
Length of database: 5,058,227,080
Length adjustment: 131
Effective length of query: 55
Effective length of database: 3,122,344,188
Effective search space: 171728930340
Effective search space used: 171728930340
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 77 (34.3 bits)