BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_8567_orf1 (186 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|261211560|ref|ZP_05925848.1| sigma factor RpoE negative regul... 37 1.6 >gi|261211560|ref|ZP_05925848.1| sigma factor RpoE negative regulatory protein RseA [Vibrio sp. RC341] gi|260839515|gb|EEX66141.1| sigma factor RpoE negative regulatory protein RseA [Vibrio sp. RC341] Length = 204 Score = 36.6 bits (83), Expect = 1.6, Method: Compositional matrix adjust. Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Query: 55 SWKLARGQAPA--HRPPHPPLGHPQKSVEISFA-LFGFPRP-QTPRLLPQWHSSFG 106 W +A A A + P H PL H QK +++ A L P+P Q R LP W + FG Sbjct: 53 EWNIAESVALALENEPAHNPLTHSQKVIDLQQARLEAQPKPQQAKRQLPTWLTQFG 108 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.328 0.142 0.481 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,503,596,151 Number of extensions: 59411257 Number of successful extensions: 175758 Number of sequences better than 10.0: 10 Number of HSP's gapped: 177092 Number of HSP's successfully gapped: 10 Length of query: 186 Length of database: 5,058,227,080 Length adjustment: 131 Effective length of query: 55 Effective length of database: 3,122,344,188 Effective search space: 171728930340 Effective search space used: 171728930340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 77 (34.3 bits)