BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_8463_orf2 (60 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|258597353|ref|XP_001348026.2| conserved Plasmodium protein [P... 46 0.002 gi|70950268|ref|XP_744472.1| hypothetical protein [Plasmodium ch... 46 0.002 gi|221056426|ref|XP_002259351.1| hypothetical protein, conserved... 45 0.003 gi|156098885|ref|XP_001615458.1| hypothetical protein [Plasmodiu... 45 0.003 gi|325119480|emb|CBZ55033.1| conserved hypothetical protein [Neo... 43 0.012 gi|237829997|ref|XP_002364296.1| hypothetical protein, conserved... 43 0.013 gi|221487366|gb|EEE25598.1| conserved hypothetical protein [Toxo... 43 0.014 >gi|258597353|ref|XP_001348026.2| conserved Plasmodium protein [Plasmodium falciparum 3D7] gi|254832679|gb|AAN35939.2| conserved Plasmodium protein [Plasmodium falciparum 3D7] Length = 174 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 21/29 (72%), Positives = 24/29 (82%) Query: 32 QKTFGMQRMKKGEHQSYGMKKGVPRECKT 60 KT+GMQR+KKGEH S+GMKKGV R KT Sbjct: 146 NKTYGMQRVKKGEHNSWGMKKGVFRSRKT 174 >gi|70950268|ref|XP_744472.1| hypothetical protein [Plasmodium chabaudi chabaudi] gi|56524439|emb|CAH77044.1| conserved hypothetical protein [Plasmodium chabaudi chabaudi] Length = 170 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 21/29 (72%), Positives = 24/29 (82%) Query: 32 QKTFGMQRMKKGEHQSYGMKKGVPRECKT 60 KT+GMQR+KKGEH S+GMKKGV R KT Sbjct: 142 NKTYGMQRVKKGEHNSWGMKKGVFRSRKT 170 >gi|221056426|ref|XP_002259351.1| hypothetical protein, conserved in Plasmodium species [Plasmodium knowlesi strain H] gi|193809422|emb|CAQ40124.1| hypothetical protein, conserved in Plasmodium species [Plasmodium knowlesi strain H] Length = 174 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 21/29 (72%), Positives = 24/29 (82%) Query: 32 QKTFGMQRMKKGEHQSYGMKKGVPRECKT 60 KT+GMQR+KKGEH S+GMKKGV R KT Sbjct: 146 NKTYGMQRVKKGEHNSWGMKKGVFRSRKT 174 >gi|156098885|ref|XP_001615458.1| hypothetical protein [Plasmodium vivax SaI-1] gi|148804332|gb|EDL45731.1| hypothetical protein, conserved [Plasmodium vivax] Length = 147 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 21/29 (72%), Positives = 24/29 (82%) Query: 32 QKTFGMQRMKKGEHQSYGMKKGVPRECKT 60 KT+GMQR+KKGEH S+GMKKGV R KT Sbjct: 119 NKTYGMQRVKKGEHNSWGMKKGVFRSRKT 147 >gi|325119480|emb|CBZ55033.1| conserved hypothetical protein [Neospora caninum Liverpool] Length = 198 Score = 43.1 bits (100), Expect = 0.012, Method: Compositional matrix adjust. Identities = 24/58 (41%), Positives = 33/58 (56%) Query: 3 FKTLIQRFRETATPSNVESLYRMRRLLLPQKTFGMQRMKKGEHQSYGMKKGVPRECKT 60 K ++ F+E P+ V + Y +RR LL MQR+K GEH YG ++G RE KT Sbjct: 141 IKEELKAFKERIKPNPVHAQYDLRRRLLVYPRQAMQRLKTGEHGGYGTRRGTIRERKT 198 >gi|237829997|ref|XP_002364296.1| hypothetical protein, conserved [Toxoplasma gondii ME49] gi|211961960|gb|EEA97155.1| hypothetical protein, conserved [Toxoplasma gondii ME49] gi|221507164|gb|EEE32768.1| conserved hypothetical protein [Toxoplasma gondii VEG] Length = 198 Score = 43.1 bits (100), Expect = 0.013, Method: Compositional matrix adjust. Identities = 24/58 (41%), Positives = 33/58 (56%) Query: 3 FKTLIQRFRETATPSNVESLYRMRRLLLPQKTFGMQRMKKGEHQSYGMKKGVPRECKT 60 K ++ F+E P+ V + Y +RR LL MQR+K GEH YG ++G RE KT Sbjct: 141 IKEELKAFKERIQPNPVHAQYDLRRKLLVYPRQAMQRLKTGEHGGYGTRRGTIRERKT 198 >gi|221487366|gb|EEE25598.1| conserved hypothetical protein [Toxoplasma gondii GT1] Length = 198 Score = 43.1 bits (100), Expect = 0.014, Method: Compositional matrix adjust. Identities = 23/54 (42%), Positives = 32/54 (59%) Query: 7 IQRFRETATPSNVESLYRMRRLLLPQKTFGMQRMKKGEHQSYGMKKGVPRECKT 60 ++ F+E P+ V + Y +RR LL MQR+K GEH YG ++G RE KT Sbjct: 145 LKAFKERIQPNPVHAQYDLRRKLLVYPRQAMQRLKTGEHGGYGTRRGTIRERKT 198 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.323 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 539,944,045 Number of extensions: 13921848 Number of successful extensions: 34166 Number of sequences better than 10.0: 7 Number of HSP's gapped: 34213 Number of HSP's successfully gapped: 7 Length of query: 60 Length of database: 5,058,227,080 Length adjustment: 33 Effective length of query: 27 Effective length of database: 4,570,561,924 Effective search space: 123405171948 Effective search space used: 123405171948 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 76 (33.9 bits)