BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_8195_orf1 (136 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|123485804|ref|XP_001324574.1| hypothetical protein [Trichomon... 36 1.6 >gi|123485804|ref|XP_001324574.1| hypothetical protein [Trichomonas vaginalis G3] gi|121907459|gb|EAY12351.1| conserved hypothetical protein [Trichomonas vaginalis G3] Length = 2064 Score = 36.2 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 17/30 (56%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 31 PVQVLLRSDFLSFYPDNFKVLDDKEYHLTP 60 P LR+DF S Y DNFK LD+K YH P Sbjct: 1781 PKSYYLRNDF-SEYTDNFKYLDEKRYHRVP 1809 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.328 0.145 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 947,888,631 Number of extensions: 31717312 Number of successful extensions: 55545 Number of sequences better than 10.0: 1 Number of HSP's gapped: 55669 Number of HSP's successfully gapped: 1 Length of query: 136 Length of database: 5,058,227,080 Length adjustment: 101 Effective length of query: 35 Effective length of database: 3,565,676,148 Effective search space: 124798665180 Effective search space used: 124798665180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 76 (33.9 bits)