BLASTP 2.2.24 [Aug-08-2010] 

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Eten_8195_orf1
         (136 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           14,777,732 sequences; 5,058,227,080 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|123485804|ref|XP_001324574.1| hypothetical protein [Trichomon...    36     1.6  

>gi|123485804|ref|XP_001324574.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121907459|gb|EAY12351.1| conserved hypothetical protein [Trichomonas vaginalis G3]
          Length = 2064

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 17/30 (56%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 31   PVQVLLRSDFLSFYPDNFKVLDDKEYHLTP 60
            P    LR+DF S Y DNFK LD+K YH  P
Sbjct: 1781 PKSYYLRNDF-SEYTDNFKYLDEKRYHRVP 1809


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
  from WGS projects
    Posted date:  Jul 22, 2011  4:42 PM
  Number of letters in database: 5,058,227,080
  Number of sequences in database:  14,777,732
  
Lambda     K      H
   0.328    0.145    0.456 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 14777732
Number of Hits to DB: 947,888,631
Number of extensions: 31717312
Number of successful extensions: 55545
Number of sequences better than 10.0: 1
Number of HSP's gapped: 55669
Number of HSP's successfully gapped: 1
Length of query: 136
Length of database: 5,058,227,080
Length adjustment: 101
Effective length of query: 35
Effective length of database: 3,565,676,148
Effective search space: 124798665180
Effective search space used: 124798665180
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 76 (33.9 bits)