BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_8040_orf2 (112 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|85859132|ref|YP_461334.1| flp pilus assembly protein [Syntrop... 37 0.89 gi|266622065|ref|ZP_06115000.1| phosphoglycolate phosphatase [Cl... 35 3.1 >gi|85859132|ref|YP_461334.1| flp pilus assembly protein [Syntrophus aciditrophicus SB] gi|85722223|gb|ABC77166.1| flp pilus assembly protein [Syntrophus aciditrophicus SB] Length = 317 Score = 37.0 bits (84), Expect = 0.89, Method: Compositional matrix adjust. Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 3/64 (4%) Query: 9 LPGVATRVASSEIVSTILSALGHWDPSLWLQVGVGSREERRPFQGFTPGDAQEFGNICCK 68 L G+A + I++ L+ +G + P+LWL++ +G+R+E + +GF DA + IC + Sbjct: 127 LAGIAVNPLAVMIITLALALVGFYLPNLWLRLKIGARKE-KIMEGFP--DALDLMVICVE 183 Query: 69 PTFG 72 G Sbjct: 184 AGMG 187 >gi|266622065|ref|ZP_06115000.1| phosphoglycolate phosphatase [Clostridium hathewayi DSM 13479] gi|288866256|gb|EFC98554.1| phosphoglycolate phosphatase [Clostridium hathewayi DSM 13479] Length = 281 Score = 35.0 bits (79), Expect = 3.1, Method: Compositional matrix adjust. Identities = 29/109 (26%), Positives = 47/109 (43%), Gaps = 9/109 (8%) Query: 7 PSLPGVATRVASSEIVSTILSALGHWDPSLWLQVGVGSREERRPFQGFTPG--DAQEFGN 64 P L A + S +L HW ++ L++G+ +E++PFQG G A F + Sbjct: 103 PELSQAALEAEIEKNHSAVLKKALHWSAAVNLKIGLLEEQEKQPFQGVGEGLAFAHRFAD 162 Query: 65 ICCKPTFGAH---RPFDV----EQLFLMLLAEAASTEEAIAQVVVLVVD 106 I + +DV E + L+L EA S I Q+++ D Sbjct: 163 IAIVSSANMEAVLEEWDVHGLLEHVDLVLAQEAGSKAYCIGQLLLKGYD 211 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.322 0.137 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,102,136,691 Number of extensions: 40405767 Number of successful extensions: 70769 Number of sequences better than 10.0: 5 Number of HSP's gapped: 71074 Number of HSP's successfully gapped: 5 Length of query: 112 Length of database: 5,058,227,080 Length adjustment: 80 Effective length of query: 32 Effective length of database: 3,876,008,520 Effective search space: 124032272640 Effective search space used: 124032272640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 76 (33.9 bits)